GLP-3 (RT) 20mg

✨ BULK DISCOUNT Get 10% OFF when you add 10+ items to cart

$75.00

GLP-3 (RT) 20MG (20mg x 10) is a high-purity research peptide analog of glucagon-like peptide-1 (GLP-1). Supplied as a lyophilized powder in sterile vials, each batch undergoes independent third-party testing to verify identity and purity (>99%). With a molecular mass of approximately 3355.8 and CAS number 204656-20-2, this research chemical is intended exclusively for laboratory and in vitro experimentation. For research use only — not for human consumption.

Category:
Description

GLP-3 (RT) 20MG Research Peptide — High-Purity GLP-1 Analog for Laboratory Use

Product Overview

GLP-3 (RT) is a research-grade synthetic peptide analog of glucagon-like peptide-1 (GLP-1). It is supplied as a sterile lyophilized powder in sealed vials. Each package contains ten vials, with each vial holding 20mg of the research compound. This product is manufactured exclusively for scientific investigation and in vitro laboratory experimentation.

Key Specifications at a Glance:

  • Quantity: 20mg per vial, 10 vials per pack

  • Form: Lyophilized (freeze-dried) powder

  • Purity: >99% verified by third-party testing

  • Molecular Mass: ~3355.8

  • CAS Number: 204656-20-2

  • Molecular Formula: C₁₄₉H₂₂₅N₃₉O₄₆

  • Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

  • Research Use Only: Not for human or animal consumption


Understanding GLP-3 (RT) 20mg: The Research Context

GLP-3 (RT) is a synthetic research peptide analog of glucagon-like peptide-1 (GLP-1), a naturally occurring incretin hormone involved in glucose metabolism and insulin regulation. This analog is designed for laboratory research focused on GLP-1 receptor signaling pathways and metabolic studies.

Key Research Interests:

  • GLP-1 receptor (GLP-1R) binding and activation studies

  • Insulin secretion and glucose homeostasis research

  • Incretin hormone analog structure-activity relationships

  • In vitro cell culture investigations

  • Metabolic signaling pathway analysis

Researchers utilize GLP-3 (RT) in controlled laboratory settings to study GLP-1 receptor biology and the mechanisms of incretin hormone signaling. The peptide is of particular interest to investigators focused on metabolic disorders, glucose regulation, and the fundamental biology of incretin hormone receptors.

The Significance of GLP-1 Research:
GLP-1 is a 30-31 amino acid peptide hormone produced by intestinal L-cells in response to nutrient intake. It plays a critical role in glucose homeostasis by:

  • Stimulating glucose-dependent insulin secretion from pancreatic beta-cells

  • Suppressing glucagon release from pancreatic alpha-cells

  • Slowing gastric emptying

  • Promoting satiety through central nervous system actions

GLP-1 analogs are valuable research tools for studying these pathways in controlled laboratory settings, helping investigators understand the molecular mechanisms underlying glucose regulation and incretin hormone signaling.


The GLP-1 Peptide Family

GLP-3 (RT) 20mg belongs to the GLP-1 analog family of research peptides. Understanding its place within this family provides important research context.

Comparison of GLP-1 and Common Analogs:

PeptideLengthPrimary Research Focus
Native GLP-1 (7-36)30 amino acidsBaseline GLP-1 receptor studies
Native GLP-1 (7-37)31 amino acidsExtended GLP-1 receptor studies
GLP-3 (RT)29 amino acidsGLP-1 analog receptor binding

Research Significance of GLP-1 Analogs:
Synthetic GLP-1 analogs like GLP-3 (RT) 20mg allow researchers to:

  • Study structure-activity relationships at the GLP-1 receptor

  • Investigate how sequence modifications affect receptor binding and activation

  • Explore the minimal structural requirements for GLP-1 receptor activation

  • Compare signaling profiles of different analog structures


Third-Party Testing and Quality Assurance

Every batch of GLP-3 (RT) undergoes rigorous independent analytical testing to verify identity, purity, and consistency. This third-party testing ensures that researchers receive a product that meets strict quality specifications before it is approved for release.

The testing process includes:

  • Identity verification through mass spectrometry

  • Purity analysis using high-performance liquid chromatography (HPLC)

  • Batch-to-batch consistency checks

  • Residual solvent analysis to confirm complete lyophilization

With a verified purity exceeding 99%, GLP-3 (RT) 20mg meets the high standards required for serious laboratory research applications. Each vial contains only the lyophilized research compound with no unnecessary additives, fillers, or excipients.


Chemical and Physical Properties

Molecular Characteristics

GLP-3 (RT) is a synthetic 29-amino acid peptide with a sequence derived from the native GLP-1 structure.

Detailed Molecular Information:

  • Molecular Formula: C₁₄₉H₂₂₅N₃₉O₄₆

  • Molecular Mass: ~3355.8 daltons

  • CAS Number: 204656-20-2

  • Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

  • Number of Amino Acids: 29

Full Sequence Breakdown with Properties:

PositionAmino AcidThree-LetterProperties
1HistidineHisPositively charged, critical for receptor binding
2AlanineAlaSmall, hydrophobic
3Glutamic AcidGluNegatively charged
4GlycineGlySmall, flexible
5ThreonineThrPolar, uncharged
6PhenylalaninePheAromatic, hydrophobic
7ThreonineThrPolar, uncharged
8SerineSerPolar, uncharged
9Aspartic AcidAspNegatively charged
10ValineValHydrophobic, branched
11SerineSerPolar, uncharged
12SerineSerPolar, uncharged
13TyrosineTyrAromatic, polar
14LeucineLeuHydrophobic
15Glutamic AcidGluNegatively charged
16GlycineGlySmall, flexible
17GlutamineGlnPolar, uncharged
18AlanineAlaSmall, hydrophobic
19AlanineAlaSmall, hydrophobic
20LysineLysPositively charged
21Glutamic AcidGluNegatively charged
22PhenylalaninePheAromatic, hydrophobic
23IsoleucineIleHydrophobic, branched
24AlanineAlaSmall, hydrophobic
25TryptophanTrpAromatic, hydrophobic
26LeucineLeuHydrophobic
27ValineValHydrophobic, branched
28LysineLysPositively charged
29GlycineGlySmall, flexible

Structural Features:

  • Linear 29-amino acid peptide

  • Contains histidine at position 1 (critical for GLP-1 receptor activation)

  • Includes multiple hydrophobic residues

  • Contains both positively and negatively charged amino acids

  • No disulfide bonds or cyclic structures

The sequence contains several residues known to be important for GLP-1 receptor binding and activation, including the N-terminal histidine and the helical region in the mid-to-C-terminal portion of the peptide.

Physical Form and Storage

The product is supplied as a lyophilized (freeze-dried) powder within a sterile, sealed vial. Lyophilization preserves the chemical integrity of the peptide by removing water content while maintaining the compound’s structure.

Recommended Storage Conditions:

  • Store lyophilized powder at -20°C (-4°F) or below for long-term preservation

  • Protect from light exposure

  • Keep desiccated to prevent moisture absorption

  • Allow vial to reach room temperature before opening to avoid condensation

  • Avoid repeated freeze-thaw cycles once reconstituted

Stability Considerations:
GLP-3 (RT) contains multiple amino acids that can be susceptible to degradation, including methionine (if present in the specific analog), tryptophan, and glutamine. Standard peptide handling precautions should be observed to maintain integrity.

Once reconstituted with an appropriate sterile solvent, the solution should be used promptly according to laboratory protocols.


Intended Use and Regulatory Status

Research Use Only

GLP-3 (RT) 20mg is classified as a research chemical and is intended exclusively for laboratory and in vitro experimentation. This designation means the product is sold strictly for:

  • In vitro testing — experiments conducted in controlled laboratory environments

  • Cell culture studies — investigating GLP-1 receptor signaling in pancreatic cell lines

  • Receptor binding assays — studying GLP-1 receptor interactions

  • Metabolic research — investigating glucose homeostasis pathways

  • Analytical research — chemical analysis and characterization studies

  • Scientific investigation — basic research into incretin hormone structure and function

Important Regulatory Notice

This product is not a drug, food, cosmetic, or medical device. Bodily introduction of any kind into humans or animals is strictly forbidden by law. The product should only be handled by licensed, qualified professionals working in appropriate laboratory facilities.

The supplier is a chemical supplier, not a compounding pharmacy or outsourcing facility under Sections 503A or 503B of the Federal Food, Drug, and Cosmetic Act. All product information provided is for educational purposes only and does not constitute medical advice or clinical recommendations.


Handling and Safety Guidelines

Professional Handling Required

GLP-3 (RT) should only be handled by trained laboratory personnel wearing appropriate personal protective equipment (PPE), including:

  • Laboratory coat

  • Nitrile gloves

  • Safety goggles or face shield

  • Appropriate respiratory protection if aerosolization is possible

Reconstitution Protocol

For laboratory use, the lyophilized powder should be reconstituted with a sterile, compatible solvent. Standard practice includes:

  1. Allow the sealed vial to reach room temperature — approximately 15-30 minutes

  2. Clean the rubber stopper with an alcohol swab

  3. Add the calculated volume of solvent to achieve desired concentration

  4. Gently swirl or roll the vial between palms — do not shake vigorously to avoid foaming and denaturation

  5. Allow complete dissolution before use — this may take 5-10 minutes due to the peptide’s length

Reconstitution Example for GLP-3 (RT) 20MG:
For researchers needing a 10mg/mL working solution, add 2mL of sterile solvent to the 20mg vial. For a 5mg/mL solution, add 4mL of solvent. For a 2mg/mL solution, add 10mL of solvent. For a 1mg/mL solution, add 20mL of solvent. Always verify calculations before proceeding with experiments.

Solvent Considerations:
Researchers should determine the appropriate solvent based on their specific experimental protocol. Common options include sterile water for injection, bacteriostatic water, or buffered solutions such as phosphate-buffered saline (PBS). The choice of solvent may affect peptide stability and should be validated for each experimental application. GLP-3 (RT) 20mg

Disposal Considerations

Dispose of GLP-3 (RT) and any contaminated materials in accordance with federal, state, and local regulations for chemical waste disposal. Do not dispose of in regular trash or down drains unless permitted by local guidelines. GLP-3 (RT) 20mg


Research Applications

GLP-3 (RT) is used in various laboratory research contexts, primarily focused on metabolic endocrinology and GLP-1 receptor signaling. Typical applications include:

GLP-1 Receptor (GLP-1R) Binding Studies:
The primary research interest in GLP-3 (RT) 20mg revolves around its interaction with the GLP-1 receptor, a class B G-protein coupled receptor (GPCR). Researchers use GLP-3 (RT) to study:

  • Receptor binding affinity and kinetics

  • Competitive binding assays with native GLP-1 and other analogs

  • Structure-activity relationships (SAR) at the GLP-1 receptor

  • Receptor binding domain mapping

Insulin Secretion Studies:
GLP-1 receptor activation stimulates glucose-dependent insulin secretion. Researchers use GLP-3 (RT) in pancreatic beta-cell culture systems to study:

  • Insulin secretion dynamics

  • Glucose-dependent insulinotropic effects

  • Beta-cell signaling pathways

  • cAMP production and downstream effectors

GPCR Signaling Research:
The GLP-1 receptor is a prototypical class B GPCR. GLP-3 (RT) 20mg serves as a research tool for:

  • GPCR activation mechanisms

  • Gs protein coupling and signaling

  • Adenylyl cyclase activation

  • cAMP response element (CRE) transcription

  • Beta-arrestin recruitment and receptor internalization

Pancreatic Cell Culture Studies:
Researchers use GLP-3 (RT) in controlled cell culture systems to investigate:

  • Beta-cell function and survival

  • Insulin gene expression

  • Cellular responses to incretin stimulation

  • Proliferation and differentiation of pancreatic cell lines

Metabolic Pathway Research:
GLP-3 (RT) is used to study downstream metabolic signaling, including:

  • PI3K/Akt pathway activation

  • MAPK/ERK signaling

  • Calcium signaling in beta-cells

  • Epigenetic changes following GLP-1 receptor activation

Receptor Selectivity and Specificity Studies:
Researchers use GLP-3 (RT) 20mg to investigate:

  • Selectivity for GLP-1R versus related receptors (GIPR, GCGR)

  • Cross-reactivity with other class B GPCRs

  • Species differences in receptor binding

Structure-Activity Relationship (SAR) Analysis:
As a synthetic analog of GLP-1, GLP-3 (RT) 20mg is valuable for:

  • Understanding how sequence modifications affect receptor activation

  • Identifying critical residues for GLP-1 receptor binding

  • Developing analogs with distinct signaling profiles

Researchers should design their experimental protocols based on peer-reviewed literature and established laboratory practices specific to GLP-1 and incretin hormone research. GLP-3 (RT) 20mg


What Makes This Product Different

GLP-1 Analog for Receptor Studies

GLP-3 (RT) is specifically designed as an analog of the native incretin hormone GLP-1, making it a valuable research tool for investigators studying GLP-1 receptor signaling, glucose homeostasis, and pancreatic beta-cell function. GLP-3 (RT) 20mg

Optimal Research Concentration

The 20mg vial size provides researchers with a quantity suitable for multiple experiments, including:

  • Dose-response curves across a range of concentrations

  • Multiple receptor binding assays

  • Replicated cell culture studies

  • Time-course experiments requiring consistent batches

Complete Sequence Documentation

The full 29-amino acid sequence is provided, allowing researchers to understand exactly which GLP-1 analog they are working with and how its structure may relate to receptor binding properties. GLP-3 (RT) 20mg

Rigorous Quality Control

Unlike research chemicals sold without verification, GLP-3 (RT) 20mg comes with documented third-party testing for every batch. This commitment to quality assurance gives researchers confidence in the consistency and reliability of their experimental results.

Complete Documentation

Each product listing includes full chemical specifications, including molecular formula, molecular mass, CAS number, and amino acid sequence. This transparency allows researchers to verify the exact compound they are working with. GLP-3 (RT) 20mg

Appropriate Packaging for Research Use

The sterile, sealed vial packaging protects the lyophilized powder from environmental contaminants. The 20mg concentration provides flexibility for various experimental designs.

Batch Traceability

Each package of GLP-3 (RT) includes batch identification numbers that allow researchers to trace their material back to original manufacturing and testing records. This traceability is essential for reproducible research and quality documentation.


Frequently Asked Questions for Researchers

What is the purity level of GLP-3 (RT) 20mg?

Each batch is tested to verify purity exceeding 99%. Individual certificates of analysis are available upon request.

How should the lyophilized powder be stored?

Store at -20°C or below, protected from light and moisture. Avoid repeated freeze-thaw cycles once reconstituted.

What solvent should be used for reconstitution?

Researchers should determine the appropriate solvent based on their specific experimental protocol. Common options include sterile water for injection, bacteriostatic water, or buffered solutions such as phosphate-buffered saline (PBS).

Is this product sterile?

The lyophilized powder is manufactured under aseptic conditions, but researchers should follow standard laboratory practices for handling research chemicals. For cell culture applications, additional filtration using a 0.22-micron filter may be appropriate.

What is the significance of the CAS number 204656-20-2?

The CAS number is a unique identifier for this GLP-1 analog, allowing researchers to verify they are working with the correct chemical compound when ordering or referencing the peptide in publications.

What is the amino acid sequence of GLP-3 (RT) 20mg?

The sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (29 amino acids).

How does GLP-3 (RT) 20mg relate to native GLP-1?

GLP-3 (RT) is a synthetic analog of native GLP-1, designed for laboratory research applications. The specific sequence modifications compared to native GLP-1 may affect receptor binding, stability, or signaling properties.

What is the significance of the 20mg vial size?

The 20mg vial size provides researchers with sufficient quantity for multiple experiments, including dose-response studies, binding assays, and cell culture investigations requiring consistent batch material.

Can GLP-3 (RT) 20mg be used in combination with other research peptides?

Researchers should determine compatibility based on their specific experimental design. Standard laboratory practice includes testing interactions in control experiments before full-scale implementation.


Final Notes for Laboratory Researchers

GLP-3 (RT) 20mg represents a high-purity research tool for qualified professionals conducting legitimate scientific investigations into GLP-1 receptor signaling, incretin hormone biology, pancreatic beta-cell function, glucose homeostasis, and related metabolic fields. With documented third-party testing, complete chemical specifications, and appropriate packaging for laboratory use, this product meets the standards expected by serious researchers.

The 20mg vial size is optimized for research applications requiring larger quantities for multiple experiments, dose-response studies, or replicated cell culture investigations. For smaller-scale research, alternative package sizes may be available.

For research use only. Not for human or animal consumption. Handle only in appropriate laboratory facilities with proper safety equipment and training.

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “GLP-3 (RT) 20mg”

Your email address will not be published. Required fields are marked *