GLP-3 (RT) 10mg
$44.99
GLP-3 (RT) 10MG (10mg x 10) is a high-purity research peptide analog of glucagon-like peptide-1 (GLP-1). Supplied as a lyophilized powder in sterile vials, each batch undergoes independent third-party testing to verify identity and purity (>99%). With a molecular mass of approximately 3355.8 and CAS number 204656-20-2, this research chemical is intended exclusively for laboratory and in vitro experimentation. For research use only — not for human consumption.
GLP-3 (RT) 10MG Research Peptide — High-Purity GLP-1 Analog for Laboratory Use
Product Overview
GLP-3 (RT) is a research-grade synthetic peptide analog of glucagon-like peptide-1 (GLP-1). It is supplied as a sterile lyophilized powder in sealed vials. Each package contains ten vials, with each vial holding 10mg of the research compound. This product is manufactured exclusively for scientific investigation and in vitro laboratory experimentation.
Key Specifications at a Glance:
Quantity: 10mg per vial, 10 vials per pack
Form: Lyophilized (freeze-dried) powder
Purity: >99% verified by third-party testing
Molecular Mass: ~3355.8
CAS Number: 204656-20-2
Molecular Formula: C₁₄₉H₂₂₅N₃₉O₄₆
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Research Use Only: Not for human or animal consumption
Understanding GLP-3 (RT): The Research Context
GLP-3 (RT) is a synthetic research peptide analog of glucagon-like peptide-1 (GLP-1), a naturally occurring incretin hormone involved in glucose metabolism and insulin regulation. This analog is designed for laboratory research focused on GLP-1 receptor signaling pathways and metabolic studies.
Key Research Interests:
GLP-1 receptor (GLP-1R) binding and activation studies
Insulin secretion and glucose homeostasis research
Incretin hormone analog structure-activity relationships
In vitro cell culture investigations
Metabolic signaling pathway analysis
Researchers utilize GLP-3 (RT) in controlled laboratory settings to study GLP-1 receptor biology and the mechanisms of incretin hormone signaling. The peptide is of particular interest to investigators focused on metabolic disorders, glucose regulation, and the fundamental biology of incretin hormone receptors.
The Significance of GLP-1 Research:
GLP-1 is a 30-31 amino acid peptide hormone produced by intestinal L-cells in response to nutrient intake. It plays a critical role in glucose homeostasis by:
Stimulating glucose-dependent insulin secretion from pancreatic beta-cells
Suppressing glucagon release from pancreatic alpha-cells
Slowing gastric emptying
Promoting satiety through central nervous system actions
GLP-1 analogs are valuable research tools for studying these pathways in controlled laboratory settings, helping investigators understand the molecular mechanisms underlying glucose regulation and incretin hormone signaling.
GLP-3 (RT) 10MG vs. 20MG: Choosing the Right Quantity for Your Research
Researchers often ask which concentration best suits their laboratory protocols. The primary difference between GLP-3 (RT) 10MG and 20MG is the mass of research compound per vial.
| Feature | GLP-3 (RT) 10MG | GLP-3 (RT) 20MG |
|---|---|---|
| Quantity per vial | 10mg | 20mg |
| Vials per pack | 10 | 10 |
| Total quantity | 100mg | 200mg |
| Best for | Smaller-scale experiments, pilot studies | Larger-scale, high-throughput studies |
| Reconstitution flexibility | Precise for low-concentration needs | More concentrated stock solutions |
Choosing the Right Vial Size:
GLP-3 (RT) 10MG — Ideal for preliminary studies, dose-finding experiments, and protocols requiring precise handling of smaller quantities
GLP-3 (RT) 20MG — Better suited for larger-scale experiments, multiple replicated assays, and established protocols requiring consistent batch material
Both products share identical chemical properties, purity standards, and quality assurance protocols. The choice between them depends entirely on the specific requirements of your research design.
The GLP-1 Peptide Family
GLP-3 (RT) belongs to the GLP-1 analog family of research peptides. Understanding its place within this family provides important research context.
Comparison of GLP-1 and Common Analogs:
| Peptide | Length | Primary Research Focus |
|---|---|---|
| Native GLP-1 (7-36) | 30 amino acids | Baseline GLP-1 receptor studies |
| Native GLP-1 (7-37) | 31 amino acids | Extended GLP-1 receptor studies |
| GLP-3 (RT) | 29 amino acids | GLP-1 analog receptor binding |
Research Significance of GLP-1 Analogs:
Synthetic GLP-1 analogs like GLP-3 (RT) allow researchers to:
Study structure-activity relationships at the GLP-1 receptor
Investigate how sequence modifications affect receptor binding and activation
Explore the minimal structural requirements for GLP-1 receptor activation
Compare signaling profiles of different analog structures
Third-Party Testing and Quality Assurance
Every batch of GLP-3 (RT) undergoes rigorous independent analytical testing to verify identity, purity, and consistency. This third-party testing ensures that researchers receive a product that meets strict quality specifications before it is approved for release.
The testing process includes:
Identity verification through mass spectrometry
Purity analysis using high-performance liquid chromatography (HPLC)
Batch-to-batch consistency checks
Residual solvent analysis to confirm complete lyophilization
With a verified purity exceeding 99%, GLP-3 (RT) meets the high standards required for serious laboratory research applications. Each vial contains only the lyophilized research compound with no unnecessary additives, fillers, or excipients.
Chemical and Physical Properties
Molecular Characteristics
GLP-3 (RT) is a synthetic 29-amino acid peptide with a sequence derived from the native GLP-1 structure.
Detailed Molecular Information:
Molecular Formula: C₁₄₉H₂₂₅N₃₉O₄₆
Molecular Mass: ~3355.8 daltons
CAS Number: 204656-20-2
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Number of Amino Acids: 29
Full Sequence Breakdown with Properties:
| Position | Amino Acid | Three-Letter | Properties |
|---|---|---|---|
| 1 | Histidine | His | Positively charged, critical for receptor binding |
| 2 | Alanine | Ala | Small, hydrophobic |
| 3 | Glutamic Acid | Glu | Negatively charged |
| 4 | Glycine | Gly | Small, flexible |
| 5 | Threonine | Thr | Polar, uncharged |
| 6 | Phenylalanine | Phe | Aromatic, hydrophobic |
| 7 | Threonine | Thr | Polar, uncharged |
| 8 | Serine | Ser | Polar, uncharged |
| 9 | Aspartic Acid | Asp | Negatively charged |
| 10 | Valine | Val | Hydrophobic, branched |
| 11 | Serine | Ser | Polar, uncharged |
| 12 | Serine | Ser | Polar, uncharged |
| 13 | Tyrosine | Tyr | Aromatic, polar |
| 14 | Leucine | Leu | Hydrophobic |
| 15 | Glutamic Acid | Glu | Negatively charged |
| 16 | Glycine | Gly | Small, flexible |
| 17 | Glutamine | Gln | Polar, uncharged |
| 18 | Alanine | Ala | Small, hydrophobic |
| 19 | Alanine | Ala | Small, hydrophobic |
| 20 | Lysine | Lys | Positively charged |
| 21 | Glutamic Acid | Glu | Negatively charged |
| 22 | Phenylalanine | Phe | Aromatic, hydrophobic |
| 23 | Isoleucine | Ile | Hydrophobic, branched |
| 24 | Alanine | Ala | Small, hydrophobic |
| 25 | Tryptophan | Trp | Aromatic, hydrophobic |
| 26 | Leucine | Leu | Hydrophobic |
| 27 | Valine | Val | Hydrophobic, branched |
| 28 | Lysine | Lys | Positively charged |
| 29 | Glycine | Gly | Small, flexible |
Structural Features:
Linear 29-amino acid peptide
Contains histidine at position 1 (critical for GLP-1 receptor activation)
Includes multiple hydrophobic residues
Contains both positively and negatively charged amino acids
No disulfide bonds or cyclic structures
The sequence contains several residues known to be important for GLP-1 receptor binding and activation, including the N-terminal histidine and the helical region in the mid-to-C-terminal portion of the peptide.
Physical Form and Storage
The product is supplied as a lyophilized (freeze-dried) powder within a sterile, sealed vial. Lyophilization preserves the chemical integrity of the peptide by removing water content while maintaining the compound’s structure.
Recommended Storage Conditions:
Store lyophilized powder at -20°C (-4°F) or below for long-term preservation
Protect from light exposure
Keep desiccated to prevent moisture absorption
Allow vial to reach room temperature before opening to avoid condensation
Avoid repeated freeze-thaw cycles once reconstituted
Stability Considerations:
GLP-3 (RT) contains multiple amino acids that can be susceptible to degradation, including tryptophan and glutamine. Standard peptide handling precautions should be observed to maintain integrity.
Once reconstituted with an appropriate sterile solvent, the solution should be used promptly according to laboratory protocols.
Intended Use and Regulatory Status
Research Use Only
GLP-3 (RT) is classified as a research chemical and is intended exclusively for laboratory and in vitro experimentation. This designation means the product is sold strictly for:
In vitro testing — experiments conducted in controlled laboratory environments
Cell culture studies — investigating GLP-1 receptor signaling in pancreatic cell lines
Receptor binding assays — studying GLP-1 receptor interactions
Metabolic research — investigating glucose homeostasis pathways
Analytical research — chemical analysis and characterization studies
Scientific investigation — basic research into incretin hormone structure and function
Important Regulatory Notice
This product is not a drug, food, cosmetic, or medical device. Bodily introduction of any kind into humans or animals is strictly forbidden by law. The product should only be handled by licensed, qualified professionals working in appropriate laboratory facilities.
The supplier is a chemical supplier, not a compounding pharmacy or outsourcing facility under Sections 503A or 503B of the Federal Food, Drug, and Cosmetic Act. All product information provided is for educational purposes only and does not constitute medical advice or clinical recommendations.
Handling and Safety Guidelines
Professional Handling Required
GLP-3 (RT) should only be handled by trained laboratory personnel wearing appropriate personal protective equipment (PPE), including:
Laboratory coat
Nitrile gloves
Safety goggles or face shield
Appropriate respiratory protection if aerosolization is possible
Reconstitution Protocol
For laboratory use, the lyophilized powder should be reconstituted with a sterile, compatible solvent. Standard practice includes:
Allow the sealed vial to reach room temperature — approximately 15-30 minutes
Clean the rubber stopper with an alcohol swab
Add the calculated volume of solvent to achieve desired concentration
Gently swirl or roll the vial between palms — do not shake vigorously to avoid foaming and denaturation
Allow complete dissolution before use — this may take 5-10 minutes due to the peptide’s length
Reconstitution Example for GLP-3 (RT) 10MG:
For researchers needing a 10mg/mL working solution, add 1mL of sterile solvent to the 10mg vial. For a 5mg/mL solution, add 2mL of solvent. For a 2mg/mL solution, add 5mL of solvent. For a 1mg/mL solution, add 10mL of solvent. Always verify calculations before proceeding with experiments.
Solvent Considerations:
Researchers should determine the appropriate solvent based on their specific experimental protocol. Common options include sterile water for injection, bacteriostatic water, or buffered solutions such as phosphate-buffered saline (PBS). The choice of solvent may affect peptide stability and should be validated for each experimental application.
Disposal Considerations
Dispose of GLP-3 (RT) and any contaminated materials in accordance with federal, state, and local regulations for chemical waste disposal. Do not dispose of in regular trash or down drains unless permitted by local guidelines.
Research Applications
GLP-3 (RT) is used in various laboratory research contexts, primarily focused on metabolic endocrinology and GLP-1 receptor signaling. Typical applications include:
GLP-1 Receptor (GLP-1R) Binding Studies:
The primary research interest in GLP-3 (RT) revolves around its interaction with the GLP-1 receptor, a class B G-protein coupled receptor (GPCR). Researchers use GLP-3 (RT) to study:
Receptor binding affinity and kinetics
Competitive binding assays with native GLP-1 and other analogs
Structure-activity relationships (SAR) at the GLP-1 receptor
Receptor binding domain mapping
Insulin Secretion Studies:
GLP-1 receptor activation stimulates glucose-dependent insulin secretion. Researchers use GLP-3 (RT) in pancreatic beta-cell culture systems to study:
Insulin secretion dynamics
Glucose-dependent insulinotropic effects
Beta-cell signaling pathways
cAMP production and downstream effectors
GPCR Signaling Research:
The GLP-1 receptor is a prototypical class B GPCR. GLP-3 (RT) serves as a research tool for:
GPCR activation mechanisms
Gs protein coupling and signaling
Adenylyl cyclase activation
cAMP response element (CRE) transcription
Beta-arrestin recruitment and receptor internalization
Pancreatic Cell Culture Studies:
Researchers use GLP-3 (RT) in controlled cell culture systems to investigate:
Beta-cell function and survival
Insulin gene expression
Cellular responses to incretin stimulation
Proliferation and differentiation of pancreatic cell lines
Metabolic Pathway Research:
GLP-3 (RT) is used to study downstream metabolic signaling, including:
PI3K/Akt pathway activation
MAPK/ERK signaling
Calcium signaling in beta-cells
Epigenetic changes following GLP-1 receptor activation
Receptor Selectivity and Specificity Studies:
Researchers use GLP-3 (RT) to investigate:
Selectivity for GLP-1R versus related receptors (GIPR, GCGR)
Cross-reactivity with other class B GPCRs
Species differences in receptor binding
Structure-Activity Relationship (SAR) Analysis:
As a synthetic analog of GLP-1, GLP-3 (RT) is valuable for:
Understanding how sequence modifications affect receptor activation
Identifying critical residues for GLP-1 receptor binding
Developing analogs with distinct signaling profiles
Researchers should design their experimental protocols based on peer-reviewed literature and established laboratory practices specific to GLP-1 and incretin hormone research.
What Makes This Product Different
GLP-1 Analog for Receptor Studies
GLP-3 (RT) is specifically designed as an analog of the native incretin hormone GLP-1, making it a valuable research tool for investigators studying GLP-1 receptor signaling, glucose homeostasis, and pancreatic beta-cell function.
Optimal 10MG Research Quantity
The 10mg vial size is ideal for:
Preliminary and pilot studies requiring smaller quantities
Dose-finding experiments across multiple concentrations
Precise handling for low-concentration protocols
Cost-effective initial investigations before scaling up
Complete Sequence Documentation
The full 29-amino acid sequence is provided, allowing researchers to understand exactly which GLP-1 analog they are working with and how its structure may relate to receptor binding properties.
Rigorous Quality Control
Unlike research chemicals sold without verification, GLP-3 (RT) comes with documented third-party testing for every batch. This commitment to quality assurance gives researchers confidence in the consistency and reliability of their experimental results.
Complete Documentation
Each product listing includes full chemical specifications, including molecular formula, molecular mass, CAS number, and amino acid sequence. This transparency allows researchers to verify the exact compound they are working with.
Appropriate Packaging for Research Use
The sterile, sealed vial packaging protects the lyophilized powder from environmental contaminants. The 10mg concentration provides flexibility for smaller-scale experimental designs.
Batch Traceability
Each package of GLP-3 (RT) includes batch identification numbers that allow researchers to trace their material back to original manufacturing and testing records. This traceability is essential for reproducible research and quality documentation.
Frequently Asked Questions for Researchers
What is the purity level of GLP-3 (RT)?
Each batch is tested to verify purity exceeding 99%. Individual certificates of analysis are available upon request.
How should the lyophilized powder be stored?
Store at -20°C or below, protected from light and moisture. Avoid repeated freeze-thaw cycles once reconstituted.
What solvent should be used for reconstitution?
Researchers should determine the appropriate solvent based on their specific experimental protocol. Common options include sterile water for injection, bacteriostatic water, or buffered solutions such as phosphate-buffered saline (PBS).
Is this product sterile?
The lyophilized powder is manufactured under aseptic conditions, but researchers should follow standard laboratory practices for handling research chemicals. For cell culture applications, additional filtration using a 0.22-micron filter may be appropriate.
What is the significance of the CAS number 204656-20-2?
The CAS number is a unique identifier for this GLP-1 analog, allowing researchers to verify they are working with the correct chemical compound when ordering or referencing the peptide in publications.
What is the amino acid sequence of GLP-3 (RT)?
The sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (29 amino acids).
How does GLP-3 (RT) relate to native GLP-1?
GLP-3 (RT) is a synthetic analog of native GLP-1, designed for laboratory research applications. The specific sequence modifications compared to native GLP-1 may affect receptor binding, stability, or signaling properties.
What is the difference between GLP-3 (RT) 10MG and 20MG?
The only difference is the quantity per vial. GLP-3 (RT) 10MG contains 10mg per vial, while GLP-3 (RT) 20MG contains 20mg per vial. Both share identical chemical properties, purity standards, and quality assurance protocols.
Which vial size should I choose for my research?
Choose 10MG for smaller-scale experiments, pilot studies, dose-finding protocols, or when precise handling of smaller quantities is required. Choose 20MG for larger-scale studies, replicated assays, or established protocols requiring consistent batch material across many experiments.
Can GLP-3 (RT) be used in combination with other research peptides?
Researchers should determine compatibility based on their specific experimental design. Standard laboratory practice includes testing interactions in control experiments before full-scale implementation.
Final Notes for Laboratory Researchers
GLP-3 (RT) 10MG represents a high-purity research tool for qualified professionals conducting legitimate scientific investigations into GLP-1 receptor signaling, incretin hormone biology, pancreatic beta-cell function, glucose homeostasis, and related metabolic fields. With documented third-party testing, complete chemical specifications, and appropriate packaging for laboratory use, this product meets the standards expected by serious researchers.
The 10mg vial size is optimized for smaller-scale experiments, preliminary studies, dose-finding protocols, and research requiring precise handling of smaller quantities. For larger-scale research requiring more material per vial, GLP-3 (RT) 20MG is available.
For research use only. Not for human or animal consumption. Handle only in appropriate laboratory facilities with proper safety equipment and training.
Related products

Reviews
There are no reviews yet.